General Information

  • ID:  hor000152
  • Uniprot ID:  Q2L9W6(27-39)
  • Protein name:  CPRP[1-13]
  • Gene name:  chh
  • Organism:  Callinectes sapidus (Blue crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Callinectes (genus), Portuninae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSAEGLGRMGRLL
  • Length:  13(27-39)
  • Propeptide:  MQSIKTVCQITLLVTCMMATLSYTHARSAEGLGRMGRLLASLKSDTVTPLRGFEGETGHPLEKRQIYDSSCKGVYDRAIFNELEHVCDDCYNLYRNSRVASGCRENCFDNMMFETCVQELFYPEDMLLVRDAIRG
  • Signal peptide:  MQSIKTVCQITLLVTCMMATLSYTHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2L9W6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000152_AF2.pdbhor000152_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 162990 Formula: C58H106N22O17S
Absent amino acids: CDFHIKNPQTVWY Common amino acids: GLR
pI: 12.2 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -30 Boman Index: -3323
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 97.69
Instability Index: 4303.08 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21740068
  • Title:  Discovery and Characterization of the Crustacean Hyperglycemic Hormone Precursor Related Peptides (CPRP) and Orcokinin Neuropeptides in the Sinus Glands of the Blue Crab?Callinectes sapidus?Using Multiple Tandem Mass Spectrometry Techniques